This corresponds to Chromium 85.0.4182.0. This roll includes: - Enable SameSiteByDefaultCookies and CookiesWithoutSameSiteMustBeSecure https://crrev.com/c/2231445 - [FlexNG] Enable FlexNG by default https://crrev.com/c/2216595 Closes #6151.
90 lines
7.5 KiB
Markdown
90 lines
7.5 KiB
Markdown
<!-- Do not edit this file. It is automatically generated by API Documenter. -->
|
|
|
|
[Home](./index.md) > [puppeteer](./puppeteer.md) > [Protocol](./puppeteer.protocol.md) > [Runtime](./puppeteer.protocol.runtime.md)
|
|
|
|
## Protocol.Runtime namespace
|
|
|
|
Runtime domain exposes JavaScript runtime by means of remote evaluation and mirror objects. Evaluation results are returned as mirror object that expose object type, string representation and unique identifier that can be used for further object reference. Original objects are maintained in memory unless they are either explicitly released or are released along with the other objects in their object group.
|
|
|
|
<b>Signature:</b>
|
|
|
|
```typescript
|
|
export namespace Runtime
|
|
```
|
|
|
|
## Enumerations
|
|
|
|
| Enumeration | Description |
|
|
| --- | --- |
|
|
| [ConsoleAPICalledEventType](./puppeteer.protocol.runtime.consoleapicalledeventtype.md) | |
|
|
| [ObjectPreviewSubtype](./puppeteer.protocol.runtime.objectpreviewsubtype.md) | |
|
|
| [ObjectPreviewType](./puppeteer.protocol.runtime.objectpreviewtype.md) | |
|
|
| [PropertyPreviewSubtype](./puppeteer.protocol.runtime.propertypreviewsubtype.md) | |
|
|
| [PropertyPreviewType](./puppeteer.protocol.runtime.propertypreviewtype.md) | |
|
|
| [RemoteObjectSubtype](./puppeteer.protocol.runtime.remoteobjectsubtype.md) | |
|
|
| [RemoteObjectType](./puppeteer.protocol.runtime.remoteobjecttype.md) | |
|
|
|
|
## Interfaces
|
|
|
|
| Interface | Description |
|
|
| --- | --- |
|
|
| [AddBindingRequest](./puppeteer.protocol.runtime.addbindingrequest.md) | |
|
|
| [AwaitPromiseRequest](./puppeteer.protocol.runtime.awaitpromiserequest.md) | |
|
|
| [AwaitPromiseResponse](./puppeteer.protocol.runtime.awaitpromiseresponse.md) | |
|
|
| [BindingCalledEvent](./puppeteer.protocol.runtime.bindingcalledevent.md) | Notification is issued every time when binding is called. |
|
|
| [CallArgument](./puppeteer.protocol.runtime.callargument.md) | Represents function call argument. Either remote object id <code>objectId</code>, primitive <code>value</code>, unserializable primitive value or neither of (for undefined) them should be specified. |
|
|
| [CallFrame](./puppeteer.protocol.runtime.callframe.md) | Stack entry for runtime errors and assertions. |
|
|
| [CallFunctionOnRequest](./puppeteer.protocol.runtime.callfunctiononrequest.md) | |
|
|
| [CallFunctionOnResponse](./puppeteer.protocol.runtime.callfunctiononresponse.md) | |
|
|
| [CompileScriptRequest](./puppeteer.protocol.runtime.compilescriptrequest.md) | |
|
|
| [CompileScriptResponse](./puppeteer.protocol.runtime.compilescriptresponse.md) | |
|
|
| [ConsoleAPICalledEvent](./puppeteer.protocol.runtime.consoleapicalledevent.md) | Issued when console API was called. |
|
|
| [CustomPreview](./puppeteer.protocol.runtime.custompreview.md) | |
|
|
| [EntryPreview](./puppeteer.protocol.runtime.entrypreview.md) | |
|
|
| [EvaluateRequest](./puppeteer.protocol.runtime.evaluaterequest.md) | |
|
|
| [EvaluateResponse](./puppeteer.protocol.runtime.evaluateresponse.md) | |
|
|
| [ExceptionDetails](./puppeteer.protocol.runtime.exceptiondetails.md) | Detailed information about exception (or error) that was thrown during script compilation or execution. |
|
|
| [ExceptionRevokedEvent](./puppeteer.protocol.runtime.exceptionrevokedevent.md) | Issued when unhandled exception was revoked. |
|
|
| [ExceptionThrownEvent](./puppeteer.protocol.runtime.exceptionthrownevent.md) | Issued when exception was thrown and unhandled. |
|
|
| [ExecutionContextCreatedEvent](./puppeteer.protocol.runtime.executioncontextcreatedevent.md) | Issued when new execution context is created. |
|
|
| [ExecutionContextDescription](./puppeteer.protocol.runtime.executioncontextdescription.md) | Description of an isolated world. |
|
|
| [ExecutionContextDestroyedEvent](./puppeteer.protocol.runtime.executioncontextdestroyedevent.md) | Issued when execution context is destroyed. |
|
|
| [GetHeapUsageResponse](./puppeteer.protocol.runtime.getheapusageresponse.md) | |
|
|
| [GetIsolateIdResponse](./puppeteer.protocol.runtime.getisolateidresponse.md) | |
|
|
| [GetPropertiesRequest](./puppeteer.protocol.runtime.getpropertiesrequest.md) | |
|
|
| [GetPropertiesResponse](./puppeteer.protocol.runtime.getpropertiesresponse.md) | |
|
|
| [GlobalLexicalScopeNamesRequest](./puppeteer.protocol.runtime.globallexicalscopenamesrequest.md) | |
|
|
| [GlobalLexicalScopeNamesResponse](./puppeteer.protocol.runtime.globallexicalscopenamesresponse.md) | |
|
|
| [InspectRequestedEvent](./puppeteer.protocol.runtime.inspectrequestedevent.md) | Issued when object should be inspected (for example, as a result of inspect() command line API call). |
|
|
| [InternalPropertyDescriptor](./puppeteer.protocol.runtime.internalpropertydescriptor.md) | Object internal property descriptor. This property isn't normally visible in JavaScript code. |
|
|
| [ObjectPreview](./puppeteer.protocol.runtime.objectpreview.md) | Object containing abbreviated remote object value. |
|
|
| [PrivatePropertyDescriptor](./puppeteer.protocol.runtime.privatepropertydescriptor.md) | Object private field descriptor. |
|
|
| [PropertyDescriptor](./puppeteer.protocol.runtime.propertydescriptor.md) | Object property descriptor. |
|
|
| [PropertyPreview](./puppeteer.protocol.runtime.propertypreview.md) | |
|
|
| [QueryObjectsRequest](./puppeteer.protocol.runtime.queryobjectsrequest.md) | |
|
|
| [QueryObjectsResponse](./puppeteer.protocol.runtime.queryobjectsresponse.md) | |
|
|
| [ReleaseObjectGroupRequest](./puppeteer.protocol.runtime.releaseobjectgrouprequest.md) | |
|
|
| [ReleaseObjectRequest](./puppeteer.protocol.runtime.releaseobjectrequest.md) | |
|
|
| [RemoteObject](./puppeteer.protocol.runtime.remoteobject.md) | Mirror object referencing original JavaScript object. |
|
|
| [RemoveBindingRequest](./puppeteer.protocol.runtime.removebindingrequest.md) | |
|
|
| [RunScriptRequest](./puppeteer.protocol.runtime.runscriptrequest.md) | |
|
|
| [RunScriptResponse](./puppeteer.protocol.runtime.runscriptresponse.md) | |
|
|
| [SetAsyncCallStackDepthRequest](./puppeteer.protocol.runtime.setasynccallstackdepthrequest.md) | |
|
|
| [SetCustomObjectFormatterEnabledRequest](./puppeteer.protocol.runtime.setcustomobjectformatterenabledrequest.md) | |
|
|
| [SetMaxCallStackSizeToCaptureRequest](./puppeteer.protocol.runtime.setmaxcallstacksizetocapturerequest.md) | |
|
|
| [StackTrace](./puppeteer.protocol.runtime.stacktrace.md) | Call frames for assertions or error messages. |
|
|
| [StackTraceId](./puppeteer.protocol.runtime.stacktraceid.md) | If <code>debuggerId</code> is set stack trace comes from another debugger and can be resolved there. This allows to track cross-debugger calls. See <code>Runtime.StackTrace</code> and <code>Debugger.paused</code> for usages. |
|
|
|
|
## Type Aliases
|
|
|
|
| Type Alias | Description |
|
|
| --- | --- |
|
|
| [ExecutionContextId](./puppeteer.protocol.runtime.executioncontextid.md) | Id of an execution context. |
|
|
| [RemoteObjectId](./puppeteer.protocol.runtime.remoteobjectid.md) | Unique object identifier. |
|
|
| [ScriptId](./puppeteer.protocol.runtime.scriptid.md) | Unique script identifier. |
|
|
| [TimeDelta](./puppeteer.protocol.runtime.timedelta.md) | Number of milliseconds. |
|
|
| [Timestamp](./puppeteer.protocol.runtime.timestamp.md) | Number of milliseconds since epoch. |
|
|
| [UniqueDebuggerId](./puppeteer.protocol.runtime.uniquedebuggerid.md) | Unique identifier of current debugger. |
|
|
| [UnserializableValue](./puppeteer.protocol.runtime.unserializablevalue.md) | Primitive value which cannot be JSON-stringified. Includes values <code>-0</code>, <code>NaN</code>, <code>Infinity</code>, <code>-Infinity</code>, and bigint literals. |
|
|
|